1

I would like to highlight certain short sequences of amino acids in a protein sequence. Choosing them by specifying their numbers works, but since some of them occur several times I would prefer to select by sequence. Although I'm doing exactly as described in the user manual, it just ignores my \shaderegion command (it should choose the four first residues in the depicted stretch).

\documentclass{article}

\usepackage{texshade} 

\begin{document}

\begin{filecontents*}{protein.fasta}
>sp|P42566|EPS15_HUMAN Epidermal growth factor receptor substrate 15 OS=Homo sapiens OX=9606 GN=EPS15 PE=1 SV=2
MAAAAQLSLTQLSSGNPVYEKYYRQVDTGNTGRVLASDAAAFLKKSGLPDLILGKIWDLA
DTDGKGILNKQEFFVALRLVACAQNGLEVSLSSLNLAVPPPRFHDTSSPLLISGTSAAEL
PWAVKPEDKAKYDAIFDSLSPVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGML
DRDEFAVAMFLVYCALEKEPVPMSLPPALVPPSKRKTWVVSPAEKAKYDEIFLKTDKDMD
GFVSGLEVREIFLKTGLPSTLLAHIWSLCDTKDCGKLSKDQFALAFHLISQKLIKGIDPP
HVLTPEMIPPSDRASLQKNIIGSSPVADFSAIKELDTLNNEIVDLQREKNNVEQDLKEKE
DTIKQRTSEVQDLQDEVQRENTNLQKLQAQKQQVQELLDELDEQKAQLEEQLKEVRKKCA
EEAQLISSLKAELTSQESQISTYEEELAKAREELSRLQQETAELEESVESGKAQLEPLQQ
HLQDSQQEISSMQMKLMEMKDLENHNSQLNWCSSPHSILVNGATDYCSLSTSSSETANLN
EHVEGQSNLESEPIHQESPARSSPELLPSGVTDENEVTTAVTEKVCSELDNNRHSKEEDP
FNVDSSSLTGPVADTNLDFFQSDPFVGSDPFKDDPFGKIDPFGGDPFKGSDPFASDCFFR
QSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTVVAASDSATDPFASVFGNESF
GGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTR
PCPLPPGKRSINKLDSPDPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADP
SNFANFSAYPSEEDMIEWAKRESEREEEQRLARLNQQEQEDLELAIALSKSEISEA
\end{filecontents*}

\begin{texshade}{protein.fasta}
\shadingmode{diverse}
\residuesperline{50}
\setdomain{1}{400..600}
\hideconsensus

\shaderegion{1}{ELDE}{Red}{Green}

\hidenames
\showruler{1}{top}
\end{texshade}

\end{document}

This version on overleaf includes the current texshade.sty file, their default one has known problems.

1 Answer 1

1

The author has now added this function for \shaderegion in the current version 1.26b on the texshade ctan.org page!

You must log in to answer this question.

Not the answer you're looking for? Browse other questions tagged .